PDB entry 1lk5

View 1lk5 on RCSB PDB site
Description: Structure of the D-Ribose-5-Phosphate Isomerase from Pyrococcus horikoshii
Class: isomerase
Keywords: alpha/beta structure, isomerase
Deposited on 2002-04-24, released 2002-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-Ribose-5-Phosphate Isomerase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lk5a1, d1lk5a2
  • Chain 'B':
    Compound: D-Ribose-5-Phosphate Isomerase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lk5b1, d1lk5b2
  • Chain 'C':
    Compound: D-Ribose-5-Phosphate Isomerase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lk5c1, d1lk5c2
  • Chain 'D':
    Compound: D-Ribose-5-Phosphate Isomerase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lk5d1, d1lk5d2
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lk5A (A:)
    mnveemkkiaakealkfieddmviglgtgsttayfikllgeklkrgeisdivgvptsyqa
    kllaiehdipiasldqvdaidvavdgadevdpnlnlikgrgaaltmekiieyragtfivl
    vderklvdylcqkmpvpievipqawkaiieelsifnakaelrmgvnkdgpvitdngnfii
    dakfpriddpldmeielntipgviengifadiadivivgtregvkkler
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lk5B (B:)
    mnveemkkiaakealkfieddmviglgtgsttayfikllgeklkrgeisdivgvptsyqa
    kllaiehdipiasldqvdaidvavdgadevdpnlnlikgrgaaltmekiieyragtfivl
    vderklvdylcqkmpvpievipqawkaiieelsifnakaelrmgvnkdgpvitdngnfii
    dakfpriddpldmeielntipgviengifadiadivivgtregvkkler
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lk5C (C:)
    mnveemkkiaakealkfieddmviglgtgsttayfikllgeklkrgeisdivgvptsyqa
    kllaiehdipiasldqvdaidvavdgadevdpnlnlikgrgaaltmekiieyragtfivl
    vderklvdylcqkmpvpievipqawkaiieelsifnakaelrmgvnkdgpvitdngnfii
    dakfpriddpldmeielntipgviengifadiadivivgtregvkkler
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lk5D (D:)
    mnveemkkiaakealkfieddmviglgtgsttayfikllgeklkrgeisdivgvptsyqa
    kllaiehdipiasldqvdaidvavdgadevdpnlnlikgrgaaltmekiieyragtfivl
    vderklvdylcqkmpvpievipqawkaiieelsifnakaelrmgvnkdgpvitdngnfii
    dakfpriddpldmeielntipgviengifadiadivivgtregvkkler