PDB entry 1lfm

View 1lfm on RCSB PDB site
Description: crystal structure of cobalt(III)-substituted cytochrome c (tuna)
Class: electron transport
Keywords: CYTOCHROME C, Folding, Intermediates, ELECTRON TRANSPORT
Deposited on 2002-04-11, released 2002-07-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Thunnus thynnus [TaxId:8237]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lfma_
  • Chain 'B':
    Compound: cytochrome c
    Species: Thunnus thynnus [TaxId:8237]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1lfmb_
  • Heterogens: COH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lfmA (A:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lfmB (B:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats