PDB entry 1ldj

View 1ldj on RCSB PDB site
Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex
Class: ligase
Keywords: cullin, rbx1, roc1, hrt1, zinc ring finger, ligase, ubiquitin, ubiquitination, SCF
Deposited on 2002-04-08, released 2002-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.247
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cullin homolog 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ldja1, d1ldja2, d1ldja3
  • Chain 'B':
    Compound: RING-box protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ldjb_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldjA (A:)
    ldqiwddlragiqqvytrqsmaksrymelythvynyctsvhqsnqargagvppskskkgq
    tpggaqfvglelykrlkeflknyltnllkdgedlmdesvlkfytqqwedyrfsskvlngi
    caylnrhwvrrecdegrkgiyeiyslalvtwrdclfrplnkqvtnavlkliekerngeti
    ntrlisgvvqsyvelglneddafakgptltvykesfesqfladterfytresteflqqnp
    vteymkkaearlleeqrrvqvylhestqdelarkceqvliekhleifhtefqnlldadkn
    edlgrmynlvsriqdglgelkkllethihnqglaaiekcgeaalndpkmyvqtvldvhkk
    ynalvmsafnndagfvaaldkacgrfinnnavtkmaqssskspellarycdsllkksskn
    peeaeledtlnqvmvvfkyiedkdvfqkfyakmlakrlvhqnsasddaeasmisklkqac
    gfeytsklqrmfqdigvskdlneqfkkhltnsepldldfsiqvlssgswpfqqsctfalp
    selersyqrftafyasrhsgrkltwlyqlskgelvtncfknrytlqastfqmaillqynt
    edaytvqqltdstqikmdilaqvlqillkskllvledenanvdevelkpdtliklylgyk
    nkklrvninvpmkteqkqeqetthknieedrklliqaaivrimkmrkvlkhqqllgevlt
    qlssrfkprvpvikkcidiliekeylervdgekdtysyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldjA (A:)
    ldqiwddlragiqqvytrqsmaksrymelythvynyctsvglelykrlkeflknyltnll
    kdgedlmdesvlkfytqqwedyrfsskvlngicaylnrhwvrrecyeiyslalvtwrdcl
    frplnkqvtnavlkliekerngetintrlisgvvqsyvelglneddafakgptltvykes
    fesqfladterfytresteflqqnpvteymkkaearlleeqrrvqvylhestqdelarkc
    eqvliekhleifhtefqnlldadknedlgrmynlvsriqdglgelkkllethihnqglaa
    iekcgeaalndpkmyvqtvldvhkkynalvmsafnndagfvaaldkacgrfinnnavtkm
    aqssskspellarycdsllkkssknpeeaeledtlnqvmvvfkyiedkdvfqkfyakmla
    krlvhqnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsepl
    dldfsiqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgelv
    tncfknrytlqastfqmaillqyntedaytvqqltdstqikmdilaqvlqillkskllvl
    edenanvdevelkpdtliklylgyknkklrvninvpmkteqkqeqetthknieedrklli
    qaaivrimkmrkvlkhqqllgevltqlssrfkprvpvikkcidiliekeylervdgekdt
    ysyla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ldjB (B:)
    kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
    fhfhcisrwlktrqvcpldnrewefqkygh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldjB (B:)
    kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
    fhfhcisrwlktrqvcpldnrewefqky