PDB entry 1l7s

View 1l7s on RCSB PDB site
Description: Crystal Structure Analysis of the Anti-testosterone Fab in Complex with Testosterone
Class: immune system
Keywords: fab fragment, anti-steroid, testosterone complex
Deposited on 2002-03-17, released 2002-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-11-23, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-testosterone (heavy chain)
    Species: MUS MUSCULUS
    Domains in SCOPe 2.07: d1l7sh3, d1l7sh4
  • Chain 'L':
    Compound: anti-testosterone (light chain)
    Species: MUS MUSCULUS
    Domains in SCOPe 2.07: d1l7sl3, d1l7sl4
  • Heterogens: TES, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7sH (H:)
    evklvesggglvkpggslklscaasgftfsryalswvrqtadkrlewvasivsggntyys
    gsvkgrftisrdiarnilylqmsslrsedtamyycarayygyvglvhwgqgtlvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7sL (L:)
    dvvvtqtplslpvslgdqasiscrssevivtrngytpiewylqkpgqspklliykaykrf
    pgvpdrfsgsgsgtdftlkisrveaedlgvyycfdgstvppkfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrdec