PDB entry 1l4a

View 1l4a on RCSB PDB site
Description: x-ray structure of the neuronal complexin/snare complex from the squid loligo pealei
Class: endocytosis/exocytosis
Keywords: SNARE, SNARE complex, membrane fusion, neurotransmission, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2002-03-04, released 2002-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.297
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: synaptobrevin
    Species: Loligo pealei [TaxId:6621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l4aa_
  • Chain 'B':
    Compound: s-syntaxin
    Species: Loligo pealei [TaxId:6621]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O46345 (0-End)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d1l4ab1, d1l4ab2
  • Chain 'C':
    Compound: S-SNAP25 fusion protein
    Species: Loligo pealei [TaxId:6621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l4ac_
  • Chain 'D':
    Compound: S-SNAP25 fusion protein
    Species: Loligo pealei [TaxId:6621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l4ad_
  • Chain 'E':
    Compound: synaphin a
    Species: Loligo pealei [TaxId:6621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l4ae_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l4aA (A:)
    pgppqgppqpvqqskrlqqtqaqveevvdimrvnvdkvlerdskiselddradalqagas
    qfeasagklkrkfwwknckm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l4aA (A:)
    qpvqqskrlqqtqaqveevvdimrvnvdkvlerdskiselddradalqagasqfeasagk
    lkrkfw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l4aB (B:)
    gksasgiimetqqakqtladiearhadimkletsirelhdmfmdmamlvesqgemidrie
    ynveaavdyietakvdtkkavkyqskar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l4aB (B:)
    gksasgiimetqqakqtladiearhadimkletsirelhdmfmdmamlvesqgemidrie
    ynveaavdyietakvdtkkavk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l4aC (C:)
    ngevevpkteleeiqqqcnqvtddslestrrmlnmceeskeagirtlvmldeqgeqldri
    eegldqinqdmkdaeknlegmek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l4aC (C:)
    kteleeiqqqcnqvtddslestrrmlnmceeskeagirtlvmldeqgeqldrieegldqi
    nqdmkdaeknleg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l4aD (D:)
    vtvgdqngmgpssgyvtritndareddmennmkevssmignlrnmaidmgneigsqnrqv
    driqqkaesnesrideankkatkllkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l4aD (D:)
    pssgyvtritndareddmennmkevssmignlrnmaidmgneigsqnrqvdriqqkaesn
    esrideankkatkll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1l4aE (E:)
    gksasgekegnenaeeeaaaieearreaeerrkekhrkmeeereemrqtirdkyglkkkv
    keepeaeadldegrvgrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l4aE (E:)
    errkekhrkmeeereemrqtirdkyglk