PDB entry 1ktr

View 1ktr on RCSB PDB site
Description: Crystal Structure of the Anti-His Tag Antibody 3D5 Single-Chain Fragment (scFv) in Complex with a Oligohistidine peptide
Class: immune system
Keywords: immunoglobulin domains, single chain antibody/antigen complex, His tag recognition, scfv, IMMUNE SYSTEM
Deposited on 2002-01-17, released 2002-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.19
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Anti-his tag antibody 3d5 variable heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Monoclonal Antibody 3D5
    Database cross-references and differences (RAF-indexed):
    • PDB 1KTR (0-113)
    Domains in SCOPe 2.03: d1ktrh_
  • Chain 'L':
    Compound: Anti-his tag antibody 3d5 variable light chain
    Species: Mus musculus [TaxId:10090]
    Gene: Monoclonal Antibody 3D5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ktrl_
  • Chain 'M':
    Compound: Peptide linker
    Species: Mus musculus [TaxId:10090]
    Gene: Monoclonal Antibody 3D5
    Database cross-references and differences (RAF-indexed):
    • PDB 1KTR
  • Chain 'P':
    Compound: Oligohistidine peptide Antigen
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1KTR (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ktrH (H:)
qvqlqqsgpedvkpgasvkisckasgytftdyymnwvkqspgkglewigdinpnnggtsy
nqkfkgratltvdkssstaymelrsltsedssvyycesqsgaywgqgttvtvsa

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >1ktrL (L:)
dykdilmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvs
nrfsgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr

    Sequence, based on observed residues (ATOM records): (download) 
    >1ktrL (L:)
dilmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr

  • Chain 'M':
    No sequence available.

  • Chain 'P':
    No sequence available.