PDB entry 1kqf

View 1kqf on RCSB PDB site
Description: formate dehydrogenase n from e. coli
Class: oxidoreductase
Keywords: oxidoreductase, selenium, selenocysteine, secys, molybdenum, molybdopterin, mpt, molybdopterin guanine dinucleotide, mgd, iron sulfur cluster, fe4s4, formate, dehydrogenase, anaerobic, integral membrane protein
Deposited on 2002-01-05, released 2002-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17700000000000002
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formate dehydrogenase, nitrate-inducible, major subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kqfa1, d1kqfa2
  • Chain 'B':
    Compound: formate dehydrogenase, nitrate-inducible, iron-sulfur subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kqfb1, d1kqfb2
  • Chain 'C':
    Compound: formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kqfc_
  • Heterogens: 6MO, SF4, MGD, HEM, CDL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kqfA (A:)
    mdvsrrqffkicaggmagttvaalgfapkqalaqarnykllrakeirntctycsvgcgll
    myslgdgaknareaiyhiegdpdhpvsrgalcpkgaglldyvnsenrlrypeyrapgsdk
    wqrisweeafsriaklmkadrdanfiekneqgvtvnrwlstgmlcasgasnetgmltqkf
    arslgmlavdnqarvahgptvaslaptfgrgamtnhwvdiknanvvmvmggnaaeahpvg
    frwameaknnndatlivvdprftrtasvadiyapirsgtditflsgvlryliennkinae
    yvkhytnasllvrddfafedglfsgydaekrqydksswnyqldengyakrdetlthprcv
    wnllkehvsrytpdvvenicgtpkadflkvcevlastsapdrtttflyalgwtqhtvgaq
    nirtmamiqlllgnmgmagggvnalrghsniqgltdlgllstslpgyltlpsekqvdlqs
    yleantpkatladqvnywsnypkffvslmksfygdaaqkennwgydwlpkwdqtydviky
    fnmmdegkvtgyfcqgfnpvasfpdknkvvsclsklkymvvidplvtetstfwqnhgesn
    dvdpasiqtevfrlpstcfaeedgsiansgrwlqwhwkgqdapgearndgeilagiyhhl
    relyqseggkgveplmkmswnykqphepqsdevakenngyaledlydangvliakkgqll
    ssfahlrddgttasscwiytgswteqgnqmanrdnsdpsglgntlgwawawplnrrvlyn
    rasadingkpwdpkrmliqwngskwtgndipdfgnaapgtptgpfimqpegmgrlfaink
    maegpfpehyepietplgtnplhpnvvsnpvvrlyeqdalrmgkkeqfpyvgttyrlteh
    fhtwtkhallnaiaqpeqfveisetlaaakginngdrvtvsskrgfiravavvtrrlkpl
    nvngqqvetvgipihwgfegvarkgyiantltpnvgdansqtpeykaflvnieka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqfA (A:)
    qarnykllrakeirntctycsvgcgllmyslgdgaknareaiyhiegdpdhpvsrgalcp
    kgaglldyvnsenrlrypeyrapgsdkwqrisweeafsriaklmkadrdanfiekneqgv
    tvnrwlstgmlcasgasnetgmltqkfarslgmlavdnqarvahgptvaslaptfgrgam
    tnhwvdiknanvvmvmggnaaeahpvgfrwameaknnndatlivvdprftrtasvadiya
    pirsgtditflsgvlryliennkinaeyvkhytnasllvrddfafedglfsgydaekrqy
    dksswnyqldengyakrdetlthprcvwnllkehvsrytpdvvenicgtpkadflkvcev
    lastsapdrtttflyalgwtqhtvgaqnirtmamiqlllgnmgmagggvnalrghsniqg
    ltdlgllstslpgyltlpsekqvdlqsyleantpkatladqvnywsnypkffvslmksfy
    gdaaqkennwgydwlpkwdqtydvikyfnmmdegkvtgyfcqgfnpvasfpdknkvvscl
    sklkymvvidplvtetstfwqnhgesndvdpasiqtevfrlpstcfaeedgsiansgrwl
    qwhwkgqdapgearndgeilagiyhhlrelyqseggkgveplmkmswnykqphepqsdev
    akenngyaledlydangvliakkgqllssfahlrddgttasscwiytgswteqgnqmanr
    dnsdpsglgntlgwawawplnrrvlynrasadingkpwdpkrmliqwngskwtgndipdf
    gnaapgtptgpfimqpegmgrlfainkmaegpfpehyepietplgtnplhpnvvsnpvvr
    lyeqdalrmgkkeqfpyvgttyrltehfhtwtkhallnaiaqpeqfveisetlaaakgin
    ngdrvtvsskrgfiravavvtrrlkplnvngqqvetvgipihwgfegvarkgyiantltp
    nvgdansqtpeykaflvnieka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kqfB (B:)
    mametqdiikrsatnsitppsqvrdykaevaklidvstcigckacqvacsewndirdevg
    hcvgvydnpadlsakswtvmrfseteqngklewlirkdgcmhcedpgclkacpsagaiiq
    yangivdfqsencigcgyciagcpfniprlnkednrvykctlcvdrvsvgqepacvktcp
    tgaihfgtkkemlelaeqrvaklkargyehagvynpegvggthvmyvlhhadqpelyhgl
    pkdpkidtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddeedhhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqfB (B:)
    ametqdiikrsatnsitppsqvrdykaevaklidvstcigckacqvacsewndirdevgh
    cvgvydnpadlsakswtvmrfseteqngklewlirkdgcmhcedpgclkacpsagaiiqy
    angivdfqsencigcgyciagcpfniprlnkednrvykctlcvdrvsvgqepacvktcpt
    gaihfgtkkemlelaeqrvaklkargyehagvynpegvggthvmyvlhhadqpelyhglp
    kdpkidtsvslwkgalkplaaagfiatfaglifhyigigpnkevdddee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kqfC (C:)
    mskskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpff
    giaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsi
    msmifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsi
    kgmiegkvsrrwakkhhprwyreiekaeakkeseegi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqfC (C:)
    skskmivrtkfidrachwtvvicfflvalsgisfffptlqwltqtfgtpqmgrilhpffg
    iaifvalmfmfvrfvhhnipdkkdipwllnivevlkgnehkvadvgkynagqkmmfwsim
    smifvllvtgviiwrpyfaqyfpmqvvrysllihaaagiilihailihmymafwvkgsik
    gmiegkvsrrwakkhhprwyreiekaeakkeseegi