PDB entry 1kpg

View 1kpg on RCSB PDB site
Description: Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and CTAB
Class: transferase
Keywords: mixed alpha beta fold, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2001-12-30, released 2002-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclopropane-fatty-acyl-phospholipid synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cmaA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q11195 (Start-286)
      • cloning artifact (42)
      • cloning artifact (65)
      • cloning artifact (78-79)
      • cloning artifact (163)
      • cloning artifact (183)
      • cloning artifact (209)
      • cloning artifact (262)
      • cloning artifact (271)
    Domains in SCOPe 2.07: d1kpga_
  • Chain 'B':
    Compound: cyclopropane-fatty-acyl-phospholipid synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cmaA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q11195 (Start-286)
      • cloning artifact (42)
      • cloning artifact (65)
      • cloning artifact (78-79)
      • cloning artifact (163)
      • cloning artifact (183)
      • cloning artifact (209)
      • cloning artifact (262)
      • cloning artifact (271)
    Domains in SCOPe 2.07: d1kpgb_
  • Chain 'C':
    Compound: cyclopropane-fatty-acyl-phospholipid synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cmaA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q11195 (Start-286)
      • cloning artifact (42)
      • cloning artifact (65)
      • cloning artifact (78-79)
      • cloning artifact (163)
      • cloning artifact (183)
      • cloning artifact (209)
      • cloning artifact (262)
      • cloning artifact (271)
    Domains in SCOPe 2.07: d1kpgc_
  • Chain 'D':
    Compound: cyclopropane-fatty-acyl-phospholipid synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cmaA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q11195 (Start-286)
      • cloning artifact (42)
      • cloning artifact (65)
      • cloning artifact (78-79)
      • cloning artifact (163)
      • cloning artifact (183)
      • cloning artifact (209)
      • cloning artifact (262)
      • cloning artifact (271)
    Domains in SCOPe 2.07: d1kpgd_
  • Heterogens: CO3, SAH, 16A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kpgA (A:)
    mpdelkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgkl
    glqpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvll
    agweqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiher
    glpmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlws
    aalqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpgA (A:)
    delkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklgl
    qpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllag
    weqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeihergl
    pmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaa
    lqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kpgB (B:)
    mpdelkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgkl
    glqpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvll
    agweqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiher
    glpmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlws
    aalqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpgB (B:)
    elkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglq
    pgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagw
    eqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiherglp
    msftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaal
    qankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kpgC (C:)
    mpdelkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgkl
    glqpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvll
    agweqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiher
    glpmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlws
    aalqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpgC (C:)
    delkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklgl
    qpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllag
    weqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeihergl
    pmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaa
    lqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kpgD (D:)
    mpdelkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgkl
    glqpgmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvll
    agweqfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiher
    glpmsftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlws
    aalqankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpgD (D:)
    lkphfanvqahydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklglqp
    gmtlldvgcgwgatmmravekydvnvvgltlsknqanhvqqlvansenlrskrvllagwe
    qfdepvdrivsigafehfgherydaffslahrllpadgvmllhtitglhpkeiherglpm
    sftfarflkfivteifpggrlpsipmvqecasangftvtrvqslqphyaktldlwsaalq
    ankgqaialqseevyerymkyltgcaemfrigyidvnqftcqk