PDB entry 1kkd

View 1kkd on RCSB PDB site
Description: Solution structure of the calmodulin binding domain (CaMBD) of small conductance Ca2+-activated potassium channels (SK2)
Class: signaling protein
Keywords: small-conductance calcium-activated potassium channel, calmodulin binding domain (cambd), channel gating, signaling protein
Deposited on 2001-12-07, released 2001-12-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Small conductance calcium-activated potassium channel protein 2
  Species: Rattus norvegicus [TaxId:10116]
  Gene: SK2 (KCNN2)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70604 (2-93)
  Domains in SCOPe 2.08: d1kkda_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1kkdA (A:)
  mgrkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhq
  rkflqaihqlrsvkmeqrklndqantlvdlaktqlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1kkdA (A:)
  rkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrk
  flqaihqlrsvkmeqrklndqantlvdlaktq