PDB entry 1kj0

View 1kj0 on RCSB PDB site
Description: solution structure of the small serine protease inhibitor sgti
Class: hydrolase
Keywords: serine protease inhibition, inhibitor specificity, HYDROLASE
Deposited on 2001-12-04, released 2001-12-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: serine protease inhibitor I
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot O46162 (0-34)
  Domains in SCOPe 2.03: d1kj0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kj0A (A:)
  eqectpgqtkkqdcntcnctptgvwactrkgcpph