PDB entry 1kil

View 1kil on RCSB PDB site
Description: Three-dimensional structure of the complexin/SNARE complex
Class: membrane protein
Keywords: Helix bound to four helix bundle, MEMBRANE PROTEIN
Deposited on 2001-12-03, released 2002-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.245
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptobrevin SNARE motif
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Synaptobrevin 2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kila_
  • Chain 'B':
    Compound: Syntaxin SNARE motif short
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Syntaxin 1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kilb_
  • Chain 'C':
    Compound: SNAP-25 N-terminal SNARE motif
    Species: Homo sapiens [TaxId:9606]
    Gene: SNAP-25
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60880 (1-72)
      • see remark 999 (1)
    Domains in SCOPe 2.07: d1kilc_
  • Chain 'D':
    Compound: SNAP-25 C-terminal SNARE motif
    Species: Homo sapiens [TaxId:9606]
    Gene: SNAP-25
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60880 (0-65)
      • see remark 999 (0-1)
      • see remark 999 (65)
    Domains in SCOPe 2.07: d1kild_
  • Chain 'E':
    Compound: Complexin I SNARE-complex binding region
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Complexin 1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kile_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kilA (A:)
    gsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkr
    kywwkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kilA (A:)
    snrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkrk
    ywwkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kilB (B:)
    gsalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
    sd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kilB (B:)
    lseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kilC (C:)
    gsleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegmnhin
    qdmkeaeknlkdlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kilC (C:)
    sleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegmnhinq
    dmkeaeknlkdl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kilD (D:)
    gsarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktrideanqr
    atkmlw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kilE (E:)
    gskdpdaakkeeerqealrqaeeerkakyakmeaerevmrqgirdkygi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kilE (E:)
    kkeeerqealrqaeeerkakyakmeaerevmrqgirdkygi