PDB entry 1kdj

View 1kdj on RCSB PDB site
Description: oxidized form of plastocyanin from dryopteris crassirhizoma
Class: electron transfer
Keywords: electron transfer, photosystem, pai-pai stacking
Deposited on 1998-05-08, released 1999-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.234
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: Adiantum capillus-veneris [TaxId:13818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kdja_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kdjA (A:)
    akvevgdevgnfkfypdsitvsageaveftlvgetghnivfdipagapgtvaselkaasm
    dendllsedepsfkakvstpgtytfyctphksanmkgtltvk