PDB entry 1kcu

View 1kcu on RCSB PDB site
Description: crystal structure of antibody pc287
Class: immune system
Keywords: anti-peptide antibody, immune system
Deposited on 2001-11-11, released 2002-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: pc287 immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kcuh1, d1kcuh2
  • Chain 'L':
    Compound: pc287 immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kcul1, d1kcul2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcuH (H:)
    qvklqqsgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmayisysgstty
    npslksrisitrdtsknqfflqlnsvttedtaiyycarggtgfdywgagttltvsaaatt
    ppsvyplapgsataaasmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsdlytl
    sssvtvpsspwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcuL (L:)
    divltqspksmsmsvgekvtlsckasenvdtyvswyqqrpeqppalliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqsysypltfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvanswtaqdskdstysmsstlt
    ltkdeyerhnsytceathktstspvvksfnrnec