PDB entry 1k91

View 1k91 on RCSB PDB site
Description: Solution Structure of Calreticulin P-domain subdomain (residues 221-256)
Class: metal transport
Keywords: hairpin, metal transport
Deposited on 2001-10-26, released 2002-10-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calreticulin
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P18418 (1-36)
    • cloning artifact (0)
  Domains in SCOPe 2.04: d1k91a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k91A (A:)
  gkpehipdpdakkpedwdeemdgeweppviqnpeykg