PDB entry 1k68

View 1k68 on RCSB PDB site
Description: Crystal Structure of the Phosphorylated Cyanobacterial Phytochrome Response Regulator RcpA
Class: signaling protein
Keywords: phosphorylated aspartate, response regulator, chey homologue, homodimer, (beta/alpha)5, SIGNALING PROTEIN
Deposited on 2001-10-15, released 2003-12-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.233
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phytochrome Response Regulator RcpA
  Species: Tolypothrix sp. PCC 7601 [TaxId:1188]
  Gene: AF309559
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RTN0 (1-139)
  Domains in SCOPe 2.04: d1k68a_
• Chain 'B':
  Compound: Phytochrome Response Regulator RcpA
  Species: Tolypothrix sp. PCC 7601 [TaxId:1188]
  Gene: AF309559
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RTN0 (1-139)
  Domains in SCOPe 2.04: d1k68b_
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k68A (A:)
  ahkkiflvednkadirliqealanstvphevvtvrdgmeamaylrqegeyanasrpdlil
  ldlnlpkkdgrevlaeiksdptlkripvvvlstsineddifhsydlhvncyitksanlsq
  lfqivkgieefwlstatlps
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k68B (B:)
  ahkkiflvednkadirliqealanstvphevvtvrdgmeamaylrqegeyanasrpdlil
  ldlnlpkkdgrevlaeiksdptlkripvvvlstsineddifhsydlhvncyitksanlsq
  lfqivkgieefwlstatlps