PDB entry 1jyt

View 1jyt on RCSB PDB site
Description: Solution structure of olfactory marker protein from rat
Class: signaling protein
Keywords: Beta-clambshell, Omega-loop, SIGNALING PROTEIN
Deposited on 2001-09-13, released 2001-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Olfactory Marker Protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08523 (0-162)
  Domains in SCOPe 2.08: d1jyta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jytA (A:)
  maedgpqkqqldmplvldqdltkqmrlrveslkqrgekkqdgekllrpaesvyrldfiqq
  qklqfdhwnvvldkpgkvtitgtsqnwtpdltnlmtrqlldpaaifwrkedsdamdwnea
  dalefgerlsdlakirkvmyflitfgegvepanlkasvvfnql