SCOPe 2.07: Structural Classification of Proteins

PDB entry 1jy8

View 1jy8 on RCSB PDB site
Description: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (IspF)
Class: biosynthetic protein
Keywords: isoprenoid biosynthesis; terpenes; malaria; drug design, biosynthetic protein
Deposited on 2001-09-11, released 2002-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P62617 (0-End)
Domains in SCOPe 2.07: d1jy8a_
Heterogens: ZN, C5P, CDI, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1jy8A (A:)
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallikatk

Sequence, based on observed residues (ATOM records): (download)

>1jy8A (A:)
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavalli