PDB entry 1ju5

View 1ju5 on RCSB PDB site
Description: ternary complex of an crk sh2 domain, crk-derived phophopeptide, and abl sh3 domain by nmr spectroscopy
Deposited on 2001-08-23, released 2002-11-06
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ju5a_
  • Chain 'C':
    Domains in SCOP 1.63: d1ju5c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ju5A (A:)
swywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinssgprppv
ppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsr

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ju5C (C:)
dpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns