PDB entry 1jn6

View 1jn6 on RCSB PDB site
Description: Crystal Structure of Fab-Estradiol Complexes
Class: immune system
Keywords: igg fold, antibody-hapten complex, estradiol, immune system
Deposited on 2001-07-23, released 2002-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal anti-estradiol 10G6D6 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1JN6 (0-209)
    Domains in SCOPe 2.07: d1jn6a1, d1jn6a2
  • Chain 'B':
    Compound: monoclonal anti-estradiol 10G6D6 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1JN6 (0-217)
    Domains in SCOPe 2.07: d1jn6b1, d1jn6b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jn6A (A:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtveksls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn6A (A:)
    qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtvksspsvtlfpps
    seeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyltlt
    arawerhssyscqvtheghtveksls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jn6B (B:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jn6B (B:)
    evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
    tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtvttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp