PDB entry 1jld

View 1jld on RCSB PDB site
Description: Potent hiv protease inhibitors containing a novel (hydroxyethyl)amide isostere
Class: hydrolase/hydrolase inhibitor
Keywords: polyprotein, hiv-2 protease, hydrolase-hydrolase inhibitor complex, aids
Deposited on 1997-05-31, released 1997-12-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-2 protease
  Species: Human immunodeficiency virus 2 [TaxId:11709]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584 (0-98)
  Domains in SCOPe 2.04: d1jlda_
• Chain 'B':
  Compound: hiv-2 protease
  Species: Human immunodeficiency virus 2 [TaxId:11709]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584 (0-98)
  Domains in SCOPe 2.04: d1jldb_
• Heterogens: 0PP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jldA (A:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jldB (B:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl