PDB entry 1jao

View 1jao on RCSB PDB site
Description: complex of 3-mercapto-2-benzylpropanoyl-ala-gly-nh2 with the catalytic domain of matrix metallo proteinase-8 (met80 form)
Deposited on 1996-03-11, released 1996-07-11
The last revision prior to the SCOP 1.57 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.183
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1jaoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jaoA (A:)
    npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
    rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
    lahssdpgalmypnyafretsnyslpqddidgiqaiyg