PDB entry 1jan

View 1jan on RCSB PDB site
Description: complex of pro-leu-gly-hydroxylamine with the catalytic domain of matrix metallo proteinase-8 (phe79 form)
Class: hydrolase/hydrolase inhibitor
Keywords: metalloprotease, zinc-endopeptidase, metzincins, hydrolase-hydrolase inhibitor complex
Deposited on 1996-03-11, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix metallo proteinase-8 (phe79 form)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jana_
  • Chain 'I':
    Compound: pro-leu-gly-hydroxylamine inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1JAN (0-3)
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1janA (A:)
fmltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadi
niafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahe
fghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

  • Chain 'I':
    No sequence available.