PDB entry 1jai

View 1jai on RCSB PDB site
Description: h-ras p21 protein mutant g12p, complexed with guanosine-5'-[beta, gamma-methylene] triphosphate and manganese
Deposited on 1996-12-15, released 1997-07-23
The last revision prior to the SCOP 1.63 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1jai__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jai_ (-)
mteyklvvvgapgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh