PDB entry 1ixa

View 1ixa on RCSB PDB site
Description: the three-dimensional structure of the first egf-like module of human factor ix: comparison with egf and tgf-a
Deposited on 1991-11-14, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ixa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ixa_ (-)
    vdgdqcesnpclnggsckddinsyecwcpfgfegkncel