PDB entry 1ivt

View 1ivt on RCSB PDB site
Description: NMR structures of the C-terminal globular domain of human lamin A/C
Class: structural protein
Keywords: Beta barrel, ALL SHEET, Ig-fold, STRUCTURAL PROTEIN
Deposited on 2002-03-29, released 2002-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lamin A/C
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02545 (0-121)
  Domains in SCOPe 2.08: d1ivta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ivtA (A:)
  ssfsqhartsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltyrfppkf
  tlkagqvvtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsv
  tv