PDB entry 1is6

View 1is6 on RCSB PDB site
Description: MES-Liganded Congerin II
Deposited on 2001-11-12, released 2002-09-18
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-18, with a file datestamp of 2002-09-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1is6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1is6A (A:)
draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli
ylagdarltfvrle