PDB entry 1ioc

View 1ioc on RCSB PDB site
Description: crystal structure of mutant human lysozyme, eaea-i56t
Class: hydrolase
Keywords: amyloid, mutant, human lysozyme, stability, HYDROLASE
Deposited on 2001-02-27, released 2002-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (4-133)
      • cloning artifact (1-3)
      • engineered (59)
    Domains in SCOPe 2.07: d1ioca1, d1ioca2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iocA (A:)
    eaeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygt
    fqinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrc
    qnrdvrqyvqgcgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iocA (A:)
    aeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygtf
    qinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcq
    nrdvrqyvqgcgv