PDB entry 1igu

View 1igu on RCSB PDB site
Description: C-terminal Domain of the Transcriptional Repressor Protein KorB
Class: transcription
Keywords: SH3 domain, dimerization domain, transcription
Deposited on 2001-04-18, released 2002-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.16
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional repressor protein KorB
    Species: Escherichia coli [TaxId:562]
    Gene: korb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1igua_
  • Chain 'B':
    Compound: Transcriptional repressor protein KorB
    Species: Escherichia coli [TaxId:562]
    Gene: korb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1igub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iguA (A:)
    kepdpdklkkaivqvehderparlilnrrppaegyawlkyeddgqefeanladvklvali
    eg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iguA (A:)
    dpdklkkaivqvehderparlilnrrppaegyawlkyeddgqefeanladvklvalieg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iguB (B:)
    kepdpdklkkaivqvehderparlilnrrppaegyawlkyeddgqefeanladvklvali
    eg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iguB (B:)
    pdpdklkkaivqvehderparlilnrrppaegyawlkyeddgqefeanladvklvalieg