PDB entry 1ig6

View 1ig6 on RCSB PDB site
Description: human mrf-2 domain, nmr, 11 structures
Class: DNA binding protein
Keywords: DNA binding protein, mrf-2, DNA-binding motif, protein-DNA interaction
Deposited on 2001-04-17, released 2001-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: modulator recognition factor 2
  Species: Homo sapiens [TaxId:9606]
  Gene: MRF-2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14865 (0-106)
  Domains in SCOPe 2.08: d1ig6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ig6A (A:)
  radeqaflvalykymkerktpieripylgfkqinlwtmfqaaqklggyetitarrqwkhi
  ydelggnpgstsaatctrrhyerlilpyerfikgeedkplppikprk