PDB entry 1icf

View 1icf on RCSB PDB site
Description: crystal structure of MHC class II associated p41 II fragment in complex with cathepsin l
Class: hydrolase
Keywords: cysteine proteinase, cathepsin, MHC class II, invariant chain, thyroglobulin type-1 domain, hydrolase
Deposited on 1999-01-07, released 2000-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cathepsin l: heavy chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07711 (0-174)
  Domains in SCOPe 2.08: d1icf.1
• Chain 'B':
  Compound: protein (cathepsin l: light chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07711 (0-41)
  Domains in SCOPe 2.08: d1icf.1
• Chain 'C':
  Compound: protein (cathepsin l: heavy chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07711 (0-174)
  Domains in SCOPe 2.08: d1icf.2
• Chain 'D':
  Compound: protein (cathepsin l: light chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07711 (0-41)
  Domains in SCOPe 2.08: d1icf.2
• Chain 'I':
  Compound: protein (invariant chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04233 (0-64)
  Domains in SCOPe 2.08: d1icfi_
• Chain 'J':
  Compound: protein (invariant chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04233 (0-64)
  Domains in SCOPe 2.08: d1icfj_
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1icfA (A:)
  aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
  gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
  almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfest
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1icfB (B:)
  nnkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1icfC (C:)
  aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
  gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
  almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfest
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1icfD (D:)
  nnkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1icfI (I:)
  ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
  ncses
  

  
  
• Chain 'J':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1icfJ (J:)
  ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
  ncses