PDB entry 1i8u

View 1i8u on RCSB PDB site
Description: family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a
Class: hydrolase
Keywords: cbm9-2, cellulose binding domain, hydrolase
Deposited on 2001-03-16, released 2001-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase A
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i8ua_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i8uA (A:)
    mvatakygtpvidgeideiwntteeietkavamgsldknatakvrvlwdenylyvlaivk
    dpvlnkdnsnpweqdsveifidennhktgyyedddaqfrvnymneqtfgtggsparfkta
    vklieggyiveaaikwktikptpntvigfniqvndanekgqrvgiiswsdptnnswrdps
    kfgnlrlik