PDB entry 1i78

View 1i78 on RCSB PDB site
Description: crystal structure of outer membrane protease ompt from escherichia coli
Class: hydrolase
Keywords: integral outer membrane protein, protease, beta barrel, HYDROLASE
Deposited on 2001-03-08, released 2001-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.238
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease vii
    Species: Escherichia coli [TaxId:83333]
    Gene: OMPT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09169 (0-296)
      • engineered (98)
      • engineered (215-216)
    Domains in SCOPe 2.07: d1i78a_
  • Chain 'B':
    Compound: protease vii
    Species: Escherichia coli [TaxId:83333]
    Gene: OMPT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09169 (Start-296)
      • engineered (98)
      • engineered (215-216)
    Domains in SCOPe 2.07: d1i78b_
  • Heterogens: BOG, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i78A (A:)
    stetlsftpdninadislgtlsgktkervylaeeggrkvsqldwkfnnaaiikgainwdl
    mpqisigaagwttlgsrggnmvdqdwmdssnpgtwtdearhpdtqlnyanefdlnikgwl
    lnepnyrlglmagyqesrysftarggsyiysseegfrddigsfpngeraigykqrfkmpy
    igltgsyryedfelggtfkysgwvessdndehydpkgrityrskvkdqnyysvavnagyy
    vtpnakvyvegawnrvtnkkgntslydhnnntsdyskngagienynfittaglkytf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i78B (B:)
    stetlsftpdninadislgtlsgktkervylaeeggrkvsqldwkfnnaaiikgainwdl
    mpqisigaagwttlgsrggnmvdqdwmdssnpgtwtdearhpdtqlnyanefdlnikgwl
    lnepnyrlglmagyqesrysftarggsyiysseegfrddigsfpngeraigykqrfkmpy
    igltgsyryedfelggtfkysgwvessdndehydpkgrityrskvkdqnyysvavnagyy
    vtpnakvyvegawnrvtnkkgntslydhnnntsdyskngagienynfittaglkytf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i78B (B:)
    ninadislgtlsgktkervylaeeggrkvsqldwkfnnaaiikgainwdlmpqisigaag
    wttlgsrggnmvdqdwmdssnpgtwtdearhpdtqlnyanefdlnikgwllnepnyrlgl
    magyqesrysftarggsyiysseegfrddigsfpngeraigykqrfkmpyigltgsyrye
    dfelggtfkysgwvessdndehydpkgrityrskvkdqnyysvavnagyyvtpnakvyve
    gawnrvtnkkgntslydhnnntsdyskngagienynfittaglkytf