PDB entry 1i6d

View 1i6d on RCSB PDB site
Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state
Class: electron transport
Keywords: electron transport, cytochrome c552, heme, redox states, isotope enrichment {13c/15n}, nmr spectroscopy, solution structure
Deposited on 2001-03-02, released 2001-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c552
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: CYCM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54820 (1-99)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1i6da_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i6dA (A:)
    madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
    alqefltnpkavvkgtkmafaglpkiedranliaylegqq