PDB entry 1i3u

View 1i3u on RCSB PDB site
Description: three-dimensional structure of a llama vhh domain complexed with the dye rr1
Class: immune system
Keywords: antibody, VHH fragment, Lama glama, IMMUNE SYSTEM
Deposited on 2001-02-16, released 2001-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.232
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antibody vhh lama domain
  Species: LAMA GLAMA [TaxId:9844]
  Database cross-references and differences (RAF-indexed):
  • PDB 1I3U (0-126)
  Domains in SCOPe 2.07: d1i3ua_
• Heterogens: SO4, RR1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i3uA (A:)
  xvqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsd
  fytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywg
  qgtqvtv