PDB entry 1i1b

View 1i1b on RCSB PDB site
Description: crystal structure of recombinant human interleukin-1beta at 2.0 angstroms resolution
Class: cytokine
Keywords: cytokine
Deposited on 1989-12-05, released 1990-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i1ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i1bA (A:)
    apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
    glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
    yistsqaenmpvflggtkggqditdftmqfvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1bA (A:)
    vrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
    keknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
    stsqaenmpvflggtkggqditdftmqfvss