PDB entry 1hyz

View 1hyz on RCSB PDB site
Description: hiv integrase core domain complexed with a derivative of tetraphenyl arsonium.
Class: transferase
Keywords: DNA integration, transferase
Deposited on 2001-01-22, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76353
      • modified residue (18)
      • modified residue (83)
      • engineered (138)
    Domains in SCOPe 2.07: d1hyza_
  • Heterogens: SO4, CL, TTO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hyzA (A:)
    gshmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklag
    rwpvktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvr
    dqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyzA (A:)
    spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
    ngsnftsttvkaacwwagikqefgqgviesmnkelkkiigqvrdqaehlktavqmavfih
    nkkrkggysagerivdiiatdiqt