PDB entry 1huz

View 1huz on RCSB PDB site
Description: crystal structure of DNA polymerase complexed with DNA and cr-pcp
Class: transferase/DNA
Keywords: protein-DNA complex, transferase/DNA complex
Deposited on 2001-01-04, released 2001-04-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1huza1, d1huza3, d1huza4
  • Chain 'B':
    Compound: DNA polymerase beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1huzb1, d1huzb3, d1huzb4
  • Chain 'C':
    Compound: 5'-d(*ap*ap*tp*ap*gp*gp*cp*gp*tp*cp*g)-3'
  • Chain 'D':
    Compound: 5'-d(p*cp*gp*ap*cp*gp*cp*cp*t)-3'
  • Chain 'P':
    Compound: 5'-d(p*cp*gp*ap*cp*gp*cp*cp*t)-3'
  • Chain 'T':
    Compound: 5'-d(*ap*ap*tp*ap*gp*gp*cp*gp*tp*cp*g)-3'
  • Heterogens: CR, MDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1huzA (A:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1huzA (A:)
    tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
    aekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkne
    dklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessg
    dmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendene
    yphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvage
    plpvdseqdifdyiqwryrepkdrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1huzB (B:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1huzB (B:)
    tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
    aekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkne
    dklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessg
    dmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendene
    yphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvage
    plpvdseqdifdyiqwryrepkdrs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.