PDB entry 1hrf

View 1hrf on RCSB PDB site
Description: solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4
Class: growth factor
Keywords: growth factor
Deposited on 1994-07-21, released 1994-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heregulin alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hrfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrfA (A:)
    gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek
    aeelyqk