PDB entry 1hre

View 1hre on RCSB PDB site
Description: solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4
Class: growth factor
Keywords: growth factor
Deposited on 1994-07-21, released 1994-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: heregulin alpha
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02297 (0-66)
  Domains in SCOPe 2.08: d1hrea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hreA (A:)
  gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek
  aeelyqk