PDB entry 1hls

View 1hls on RCSB PDB site
Description: nmr structure of the human insulin-his(b16)
Class: hormone
Keywords: hormone
Deposited on 1995-06-28, released 1995-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hls.1
  • Chain 'B':
    Compound: insulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-29)
      • conflict (15)
    Domains in SCOPe 2.04: d1hls.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlsA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlsB (B:)
    fvnqhlcgshlvealhlvcgergffytpkt