PDB entry 1hiq

View 1hiq on RCSB PDB site
Description: paradoxical structure and function in a mutant human insulin associated with diabetes mellitus
Class: hormone
Keywords: hormone
Deposited on 1993-03-05, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.04: d1hiq.1
• Chain 'B':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered mutation (23)
  Domains in SCOPe 2.04: d1hiq.1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hiqA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hiqB (B:)
  fvnqhlcgshlvealylvcgergsfytpkt