PDB entry 1hd3

View 1hd3 on RCSB PDB site
Description: a-spectrin sh3 domain f52y mutant
Class: cytoskeleton
Keywords: sh3-domain, cytoskeleton, calmodulin-binding, actin-binding
Deposited on 2000-11-06, released 2001-11-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.245
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin alpha chain
    Species: GALLUS GALLUS [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (Start-61)
      • engineered mutation (51)
    Domains in SCOPe 2.03: d1hd3a_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hd3A (A:)
    mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgyvpaayvkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hd3A (A:)
    gkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgyvpaayvkkld