PDB entry 1hcr

View 1hcr on RCSB PDB site
Description: hin recombinase bound to DNA: the origin of specificity in major and minor groove interactions
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, DNA binding protein/DNA complex
Deposited on 1993-12-17, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hin recombinase)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hcra_
  • Chain 'B':
    Compound: DNA (5'-d(*tp*gp*tp*tp*tp*tp*tp*gp*ap*tp*ap*ap*gp*a)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*cp*tp*tp*ap*tp*cp*ap*ap*ap*ap*ap*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hcrA (A:)
    grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassikkrmn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.