PDB entry 1h5p

View 1h5p on RCSB PDB site
Description: Solution structure of the human Sp100b SAND domain by heteronuclear NMR.
Class: nuclear protein
Keywords: transcription, DNA binding, sp100b, sand domain, kdwk, antigen, nuclear protein, alternative splicing
Deposited on 2001-05-24, released 2001-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nuclear autoantigen sp100-b
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1H5P (0-0)
    • variant (91-94)
  • Uniprot P23497 (1-94)
  Domains in SCOPe 2.08: d1h5pa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h5pA (A:)
  mdeninfkqselpvtcgevkgtlykerfkqgtskkciqsedkkwftprefeiegdrgask
  nwklsircggytlkvlmenkflpeppstrkkvtik