PDB entry 1gwp

View 1gwp on RCSB PDB site
Description: structure of the n-terminal domain of the mature hiv-1 capsid protein
Deposited on 2002-03-22, released 2002-06-21
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-21, with a file datestamp of 2002-06-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1gwpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gwpA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsil