PDB entry 1gvv

View 1gvv on RCSB PDB site
Description: five atomic resolution structures of endothiapepsin inhibitor complexes; implications for the aspartic proteinase mechanism
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, aspartic proteinase mechanism, z tetrahedral intermediate, hydrolase- hydrolase inhibitor complex
Deposited on 2002-02-27, released 2002-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.116
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: ENDOTHIA PARASITICA [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gvva_
  • Heterogens: 0GM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gvvA (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask