PDB entry 1gvk

View 1gvk on RCSB PDB site
Description: Porcine pancreatic elastase acyl enzyme at 0.95 A resolution
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex
Deposited on 2002-02-14, released 2002-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: N/A
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide inhibitor
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GVK (Start-2)
  • Chain 'B':
    Compound: Elastase 1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gvkb_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gvkB (B:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn