PDB entry 1gh4

View 1gh4 on RCSB PDB site
Description: Structure of the triple mutant (K56M, K120M, K121M) of phospholipase A2
Class: hydrolase
Keywords: Alpha Helix, Beta Sheet, Triple mutant, HYDROLASE
Deposited on 2000-11-09, released 2001-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • engineered (55)
    • engineered (119-120)
  Domains in SCOPe 2.07: d1gh4a_
• Heterogens: CA, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gh4A (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqamklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
  mnc