PDB entry 1gf3

View 1gf3 on RCSB PDB site
Description: buried polar mutant human lysozyme
Class: hydrolase
Keywords: buried polar, stability, HYDROLASE
Deposited on 2000-11-30, released 2001-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (91)
    Domains in SCOPe 2.07: d1gf3a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gf3A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadsvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv