PDB entry 1gbi

View 1gbi on RCSB PDB site
Description: alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu complex with methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid
Deposited on 1995-09-06, released 1996-01-29
The last revision prior to the SCOP 1.63 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.135
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1gbia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gbiA (A:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
    anyaegavrgltqgnacagrgdsggswitsagqaqgvmsglnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg